PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G16770.1
Common NameAtMYB9, MYB9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 336aa    MW: 38080.3 Da    PI: 6.186
Description myb domain protein 9
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G16770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d ++++G g+W++ ++  g++R++k+c++rw +yl
      AT5G16770.1 14 KGPWTQEEDDKLIDHIQKHGHGSWRALPKQAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding56.56.5e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE++ +++++ +lG++ W++Ia  ++ gRt++++k++w+++l
      AT5G16770.1  67 RGNFTEEEEQTIINLHSLLGNK-WSSIAGNLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.142961IPR017930Myb domain
SuperFamilySSF466896.24E-3211108IPR009057Homeodomain-like
SMARTSM007171.5E-151363IPR001005SANT/Myb domain
PfamPF002493.6E-171461IPR001005SANT/Myb domain
CDDcd001673.77E-121661No hitNo description
PROSITE profilePS5129427.77462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2765116IPR009057Homeodomain-like
SMARTSM007171.3E-1666114IPR001005SANT/Myb domain
PfamPF002492.0E-1667112IPR001005SANT/Myb domain
CDDcd001672.15E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009737Biological Processresponse to abscisic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTQE EDDKLIDHIQ KHGHGSWRAL PKQAGLNRCG KSCRLRWTNY  60
LRPDIKRGNF TEEEEQTIIN LHSLLGNKWS SIAGNLPGRT DNEIKNYWNT HLRKKLLQMG  120
IDPVTHRPRT DHLNVLAALP QLIAAANFNS LLNLNQNVQL DATTLAKAQL LHTMIQVLST  180
NNNTTNPSFS SSTMQNSNTN LFGQASYLEN QNLFGQSQNF SHILEDENLM VKTQIIDNPL  240
DSFSSPIQPG FQDDHNSLPL LVPASPEESK ETQRMIKNKD IVDYHHHDAS NPSSSNSTFT  300
QDHHHPWCDT IDDGASDSFW KEIIEQTCSE PWPFPE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-311211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.99320.0root| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible246477_at0.0
Expression AtlasAT5G16770-
AtGenExpressAT5G16770-
ATTED-IIAT5G16770-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G16770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G16770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196260.0AY519626.1 Arabidopsis thaliana MYB transcription factor (At5g16770) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197179.20.0myb domain protein 9
RefseqNP_974792.10.0myb domain protein 9
TrEMBLF4KE690.0F4KE69_ARATH; Myb domain protein 9
STRINGAT5G16770.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]